PDB entry 1xyx

View 1xyx on RCSB PDB site
Description: mouse prion protein fragment 121-231
Class: Unknown Function
Keywords: NMR, prion, mPrP, TSE, prion protein, Unknown Function
Deposited on 2004-11-11, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xyxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyxA (A:)
    vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcv
    nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss