PDB entry 1xyx

View 1xyx on RCSB PDB site
Description: mouse prion protein fragment 121-231
Deposited on 2004-11-11, released 2004-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xyxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xyxA (A:)
vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcv
nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss