PDB entry 1xyw

View 1xyw on RCSB PDB site
Description: elk prion protein
Class: unknown function
Keywords: NMR, PrP, CWD, prion protein, TSE, UNKNOWN FUNCTION
Deposited on 2004-11-11, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Cervus elaphus nelsoni [TaxId:9864]
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67986 (0-110)
  Domains in SCOPe 2.08: d1xywa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xywA (A:)
  vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcv
  nitvkqhtvttttkgenftetdikmmervveqmcitqyqreseayyqrgas