PDB entry 1xyu

View 1xyu on RCSB PDB site
Description: Solution structure of the sheep prion protein with polymorphism H168
Class: unknown function
Keywords: NMR, prion, TSE, ovPrP, PrP, UNKNOWN FUNCTION
Deposited on 2004-11-11, released 2005-01-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Ovis aries [TaxId:9940]
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23907 (0-110)
    • see remark 999 (47)
  Domains in SCOPe 2.01: d1xyua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xyuA (A:)
  vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdhysnqnnfvhdcv
  nitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas