PDB entry 1xys

View 1xys on RCSB PDB site
Description: catalytic core of xylanase a e246c mutant
Class: hydrolase
Keywords: family f xylanase, family 10 of glycosyl-hydrolase
Deposited on 1994-09-02, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase a
    Species: Cellvibrio japonicus [TaxId:155077]
    Gene: TRUNCATED XYNA (CODONS 264-611)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14768 (0-End)
      • conflict (245)
    Domains in SCOPe 2.07: d1xysa_
  • Chain 'B':
    Compound: xylanase a
    Species: Cellvibrio japonicus [TaxId:155077]
    Gene: TRUNCATED XYNA (CODONS 264-611)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14768 (0-End)
      • conflict (245)
    Domains in SCOPe 2.07: d1xysb_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xysA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xysA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xysB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xysB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals