PDB entry 1xyr

View 1xyr on RCSB PDB site
Description: Poliovirus 135S cell entry intermediate
Class: Virus
Keywords: BETA BARREL, VIRAL CAPSID, CELL ENTRY INTERMEDIATE, Icosahedral virus
Deposited on 2004-11-10, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 11 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Genome polyprotein, Coat protein VP1
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyr11
  • Chain '2':
    Compound: Genome polyprotein, Coat protein VP2
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Genome polyprotein, Coat protein VP3
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03300 (0-181)
      • see remark 999 (73)
  • Chain '5':
    Compound: Genome polyprotein, Coat protein VP3
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: Genome polyprotein, Coat protein VP3
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: Genome polyprotein, Coat protein VP2
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: Genome polyprotein, Coat protein VP1
    Species: Human poliovirus 1 [TaxId:12080]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyr1 (1:)
    srsessiesffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrklefftysrf
    dmeltfvvtanftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifytygta
    parisvpyvgisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvndhnp
    tkvtskirvylkpkhirvwcprppravayygpgvdykdgtltplstkdltty
    

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.