PDB entry 1xyq

View 1xyq on RCSB PDB site
Description: NMR structure of the pig prion protein
Class: unknown function
Keywords: nmr, prion, prp, scprp, tse, UNKNOWN FUNCTION
Deposited on 2004-11-10, released 2005-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Sus scrofa [TaxId:9823]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xyqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyqA (A:)
    vvgglggymlgsamsrplihfgsdyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcv
    nitvkqhtvttttkgenftetdvkmiervveqmcitqyqkeyeayaqrgas