PDB entry 1xyn

View 1xyn on RCSB PDB site
Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
Class: hydrolase
Keywords: xylanase
Deposited on 1994-08-09, released 1995-08-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase I
    Species: Trichoderma reesei
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xyna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xynA (A:)
asinydqnyqtggqvsyspsntgfsvnwntqddfvvgvgwttgssapinfggsfsvnsgt
gllsvygwstnplveyyimednhnypaqgtvkgtvtsdgatytiwentrvnepsiqgtat
fnqyisvrnsprtsgtvtvqnhfnawaslglhlgqmnyqvvavegwggsgsasqsvsn