PDB entry 1xyl

View 1xyl on RCSB PDB site
Description: the role of the divalent metal ion in sugar binding, ring opening, and isomerization by d-xylose isomerase: replacement of a catalytic metal by an amino-acid
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1993-12-07, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces olivochromogenes [TaxId:1963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15587
      • conflict (179)
    Domains in SCOPe 2.08: d1xyla_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Streptomyces olivochromogenes [TaxId:1963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15587 (0-385)
      • conflict (179)
    Domains in SCOPe 2.08: d1xylb_
  • Heterogens: MG, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xylA (A:)
    syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
    gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtrfaik
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
    saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
    vdaaaargmaferldqlamdhllgar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xylB (B:)
    syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
    gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtrfaik
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
    saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
    vdaaaargmaferldqlamdhllgar