PDB entry 1xyk

View 1xyk on RCSB PDB site
Description: NMR Structure of the canine prion protein
Class: unknown function
Keywords: NMR, PrP, prion, Prnp, cPrP, UNKNOWN FUNCTION
Deposited on 2004-11-10, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xykA (A:)
    vvgglggymlgsamsrplihfgndyedryyrenmyrypdqvyyrpvdqysnqnnfvrdcv
    nitvkqhtvttttkgenftetdmkimervveqmcvtqyqkeseayyqrgas