PDB entry 1xyj

View 1xyj on RCSB PDB site
Description: NMR Structure of the cat prion protein
Class: unknown function
Keywords: NMR, prion, TSE, PrP, Prnp
Deposited on 2004-11-10, released 2005-01-04
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: prion protein
  Species: Felis silvestris catus
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5YCW7 (0-110)
  Domains in SCOP 1.75: d1xyja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xyjA (A:)
  vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcv
  nitvrqhtvttttkgenftetdmkimervveqmcvtqyqkeseayyqrras