PDB entry 1xyi

View 1xyi on RCSB PDB site
Description: Hyperthermophile chromosomal protein Sac7d double mutant Val26Ala/Met29Ala in complex with DNA GCGATCGC
Class: structural protein/DNA
Keywords: PROTEIN-DNA COMPLEX, Oligonucleotide binding fold, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2004-11-10, released 2005-02-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.214
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding proteins 7a/7b/7d
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: sac7d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123 (0-65)
      • engineered (25)
      • engineered (28)
    Domains in SCOPe 2.01: d1xyia_
  • Chain 'B':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyiA (A:)
    mvkvkfkykgeekevdtskikkvwragkavsftyddngktgrgavsekdapkelldmlar
    aerekk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.