PDB entry 1xyh

View 1xyh on RCSB PDB site
Description: Crystal Structure of Recombinant Human Cyclophilin J
Class: isomerase
Keywords: cyclophilin J, beta-barrel, helix, disulfide bridge, ISOMERASE
Deposited on 2004-11-10, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin-like protein PPIL3b
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIL3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyha1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xyhA (A:)
    msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
    rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
    vidgletldeleklpvnektyrplndvhikditihanpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xyhA (A:)
    msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
    rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
    vidgletldeleklpvnektyrplndvhikditihanpfa