PDB entry 1xyd

View 1xyd on RCSB PDB site
Description: NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures
Class: Metal Binding Protein
Keywords: Metal Binding Protein
Deposited on 2004-11-09, released 2005-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100 protein, beta chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xyda1
  • Chain 'B':
    Compound: S-100 protein, beta chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xydb1
  • Heterogens: CA, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xydA (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xydB (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe