PDB entry 1xyd
View 1xyd on RCSB PDB site
Description: NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures
Class: Metal Binding Protein
Keywords: Metal Binding Protein
Deposited on
2004-11-09, released
2005-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: S-100 protein, beta chain
Species: Rattus norvegicus [TaxId:10116]
Gene: S100B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1xyda1 - Chain 'B':
Compound: S-100 protein, beta chain
Species: Rattus norvegicus [TaxId:10116]
Gene: S100B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1xydb1 - Heterogens: CA, ZN
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1xydA (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1xydB (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe