PDB entry 1xya

View 1xya on RCSB PDB site
Description: x-ray crystallographic structures of d-xylose isomerase-substrate complexes position the substrate and provide evidence for metal movement during catalysis
Class: isomerase, oxidoreductase
Keywords: isomerase(intramolecular oxidoreductase), isomerase, oxidoreductase
Deposited on 1994-01-03, released 1994-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces olivochromogenes [TaxId:1963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyaa_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Streptomyces olivochromogenes [TaxId:1963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyab_
  • Heterogens: MG, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyaA (A:)
    syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
    gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtrfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
    saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
    vdaaaargmaferldqlamdhllgar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyaB (B:)
    syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
    gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtrfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
    saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
    vdaaaargmaferldqlamdhllgar