PDB entry 1xy7

View 1xy7 on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at5g48480
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AT5G48480, REDUCTIVELY METHYLATED PROTEIN, CATH 3.10.180 FOLD, UNKNOWN FUNCTION, DIMER, Center for Eukaryotic Structural Genomics
Deposited on 2004-11-09, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g48480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LV66
      • modified residue (28)
    Domains in SCOPe 2.07: d1xy7a_
  • Chain 'B':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g48480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LV66
      • modified residue (28)
    Domains in SCOPe 2.07: d1xy7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xy7A (A:)
    maqedvtavatngagpvethlvftefkqmllveaqkvgdavtfyksafgaiesghslypk
    rkldqelphvlsselnlagssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakav
    dagavkvevteaevelgfkgkvtdpfgvtwifaekktvitdenkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xy7A (A:)
    hlvftefkqmllveaqkvgdavtfyksafgaieshvlsselnlagssfvvcdvsslpgfs
    taksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwifae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xy7B (B:)
    maqedvtavatngagpvethlvftefkqmllveaqkvgdavtfyksafgaiesghslypk
    rkldqelphvlsselnlagssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakav
    dagavkvevteaevelgfkgkvtdpfgvtwifaekktvitdenkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xy7B (B:)
    vftefkqmllveaqkvgdavtfyksafgaiesghslhvlsselnlagssfvvcdvsslpg
    fstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwif
    ae