PDB entry 1xxw
View 1xxw on RCSB PDB site
Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution
Class: hydrolase
Keywords: venom, esterolytic activity, zinc induced, dimer, HYDROLASE
Deposited on
2004-11-09, released
2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Phospholipase A2 isoform 1
Species: Naja sagittifera [TaxId:195058]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1xxwa_ - Chain 'B':
Compound: Phospholipase A2 isoform 2
Species: Naja sagittifera [TaxId:195058]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1xxwb_ - Heterogens: ZN, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1xxwA (A:)
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1xxwB (B:)
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn