PDB entry 1xxv

View 1xxv on RCSB PDB site
Description: Yersinia YopH (residues 163-468) binds phosphonodifluoromethyl-Phe containing hexapeptide at two sites
Class: hydrolase
Keywords: catalytic domain, phosphotyrosine-binding sites, substrate targeting, HYDROLASE
Deposited on 2004-11-08, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase yoph
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d1xxva1
  • Chain 'B':
    Compound: protein-tyrosine phosphatase yoph
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d1xxvb1
  • Chain 'C':
    Compound: Epidermal growth factor receptor derived peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXV
  • Chain 'D':
    Compound: Epidermal growth factor receptor derived peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXV (0-5)
  • Chain 'E':
    Compound: Epidermal growth factor receptor derived peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXV
  • Chain 'F':
    Compound: Epidermal growth factor receptor derived peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXV (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxvA (A:)
    prerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxvA (A:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxvB (B:)
    prerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxvB (B:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.