PDB entry 1xxu

View 1xxu on RCSB PDB site
Description: Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin
Class: oxidoreductase
Keywords: 1-cys peroxiredoxin, thioredoxin fold, structural genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2004-11-08, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.242
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv2238c/MT2298
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rv2238c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxua_
  • Chain 'B':
    Compound: Hypothetical protein Rv2238c/MT2298
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rv2238c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxub_
  • Chain 'C':
    Compound: Hypothetical protein Rv2238c/MT2298
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rv2238c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxuc_
  • Chain 'D':
    Compound: Hypothetical protein Rv2238c/MT2298
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rv2238c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxuA (A:)
    mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
    nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
    vdrsgiirfaemkqpgevrdqrlwtdalaalta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxuB (B:)
    mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
    nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
    vdrsgiirfaemkqpgevrdqrlwtdalaalta
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxuC (C:)
    mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
    nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
    vdrsgiirfaemkqpgevrdqrlwtdalaalta
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxuD (D:)
    mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
    nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
    vdrsgiirfaemkqpgevrdqrlwtdalaalta