PDB entry 1xxs

View 1xxs on RCSB PDB site
Description: Structural insights for fatty acid binding in a Lys49 phospholipase A2: crystal structure of myotoxin II from Bothrops moojeni complexed with stearic acid
Class: hydrolase
Keywords: phospholipase A2, stearic acid, crystal structure, dimer interface, fatty acid binding, HYDROLASE
Deposited on 2004-11-08, released 2005-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I834 (0-121)
      • conflict (114)
    Domains in SCOPe 2.06: d1xxsa_
  • Chain 'B':
    Compound: Phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I834 (0-121)
      • conflict (114)
    Domains in SCOPe 2.06: d1xxsb_
  • Heterogens: SO4, STE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxsA (A:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad
    pc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxsB (B:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpackkad
    pc