PDB entry 1xxr

View 1xxr on RCSB PDB site
Description: Structure of a mannose-specific jacalin-related lectin from Morus Nigra in complex with mannose
Class: sugar binding protein
Keywords: tetrameric b-prism fold, SUGAR BINDING PROTEIN
Deposited on 2004-11-08, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding lectin
    Species: Morus nigra [TaxId:85232]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGR3 (Start-160)
      • see remark 999 (16)
      • see remark 999 (99)
      • see remark 999 (156)
    Domains in SCOPe 2.07: d1xxra_
  • Chain 'B':
    Compound: mannose-binding lectin
    Species: Morus nigra [TaxId:85232]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGR3 (Start-160)
      • see remark 999 (16)
      • see remark 999 (99)
      • see remark 999 (156)
    Domains in SCOPe 2.07: d1xxrb_
  • Chain 'C':
    Compound: mannose-binding lectin
    Species: Morus nigra [TaxId:85232]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGR3 (Start-160)
      • see remark 999 (16)
      • see remark 999 (99)
      • see remark 999 (156)
    Domains in SCOPe 2.07: d1xxrc_
  • Chain 'D':
    Compound: mannose-binding lectin
    Species: Morus nigra [TaxId:85232]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LGR3 (Start-160)
      • see remark 999 (16)
      • see remark 999 (99)
      • see remark 999 (156)
    Domains in SCOPe 2.07: d1xxrd_
  • Heterogens: MAN, SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxrA (A:)
    magtstntqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlng
    qpftgpthpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkkt
    ygpygkeegtpfslpienglivgfkgrsgfvvdaigfhlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxrA (A:)
    tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt
    hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke
    egtpfslpienglivgfkgrsgfvvdaigfhlsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxrB (B:)
    magtstntqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlng
    qpftgpthpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkkt
    ygpygkeegtpfslpienglivgfkgrsgfvvdaigfhlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxrB (B:)
    tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt
    hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke
    egtpfslpienglivgfkgrsgfvvdaigfhlsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxrC (C:)
    magtstntqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlng
    qpftgpthpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkkt
    ygpygkeegtpfslpienglivgfkgrsgfvvdaigfhlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxrC (C:)
    tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt
    hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke
    egtpfslpienglivgfkgrsgfvvdaigfhlsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxrD (D:)
    magtstntqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlng
    qpftgpthpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkkt
    ygpygkeegtpfslpienglivgfkgrsgfvvdaigfhlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxrD (D:)
    tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt
    hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke
    egtpfslpienglivgfkgrsgfvvdaigfhlsl