PDB entry 1xxp

View 1xxp on RCSB PDB site
Description: Yersinia YopH (residues 163-468) C403S binds phosphotyrosyl peptide at two sites
Class: hydrolase/hydrolase inhibitor
Keywords: Peptide binds at site remote from catalytic site. Important for protein localization in infected cell., HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-11-07, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.181
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase yoph
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered (72)
      • engineered (240)
    Domains in SCOPe 2.07: d1xxpa1
  • Chain 'B':
    Compound: protein-tyrosine phosphatase yoph
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered (72)
      • engineered (240)
    Domains in SCOPe 2.07: d1xxpb1
  • Chain 'C':
    Compound: Hexapeptide ASP-ALA-ASP-GLU-PTR-CLE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXP
  • Chain 'D':
    Compound: Hexapeptide ASP-ALA-ASP-GLU-PTR-CLE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXP
  • Chain 'E':
    Compound: Hexapeptide ASP-ALA-ASP-GLU-PTR-CLE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXP
  • Chain 'F':
    Compound: Hexapeptide ASP-ALA-ASP-GLU-PTR-CLE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XXP
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxpA (A:)
    prerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    sragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxpA (A:)
    apstvspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavr
    adlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdy
    frqsgtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavs
    sevtkalaslvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmnd
    srnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxpB (B:)
    prerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    sragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxpB (B:)
    vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
    anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
    gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
    kalaslvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrns
    qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.