PDB entry 1xxo

View 1xxo on RCSB PDB site
Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase at 1.8 a resolution
Class: oxidoreductase
Keywords: PYRIDOXINE 5'-PHOSPHATE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2004-11-07, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv1155
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV1155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxoa_
  • Chain 'B':
    Compound: hypothetical protein Rv1155
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: RV1155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxoA (A:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxoA (A:)
    vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
    prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
    vtdrrvlltlpishvyglppgmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxoB (B:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxoB (B:)
    vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
    prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
    vtdrrvlltlpishvyglppgmr