PDB entry 1xxn

View 1xxn on RCSB PDB site
Description: Crystal structure of a mesophilic xylanase A from Bacillus subtilis 1A1
Class: hydrolase
Keywords: family 11 xylanase, thermostability, hydrolase
Deposited on 2004-11-07, released 2005-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase A
  Species: Bacillus subtilis [TaxId:1423]
  Gene: xynA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18429 (0-184)
  Domains in SCOPe 2.06: d1xxna_
• Heterogens: SRT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xxnA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
  nvtvw