PDB entry 1xxn

View 1xxn on RCSB PDB site
Description: Crystal structure of a mesophilic xylanase A from Bacillus subtilis 1A1
Class: hydrolase
Keywords: family 11 xylanase, thermostability, hydrolase
Deposited on 2004-11-07, released 2005-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xynA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xxna_
  • Heterogens: SRT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxnA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw