PDB entry 1xxl

View 1xxl on RCSB PDB site
Description: The crystal structure of YcgJ protein from Bacillus subitilis at 2.1 A resolution
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, probable methyltransferase, UNKNOWN FUNCTION
Deposited on 2004-11-05, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YcgJ protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Ycgj
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31474 (10-236)
      • expression tag (5-9)
      • modified residue (12)
      • modified residue (54)
      • modified residue (159)
      • cloning artifact (237-238)
    Domains in SCOPe 2.07: d1xxla1, d1xxla2, d1xxla3
  • Chain 'B':
    Compound: YcgJ protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Ycgj
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31474 (10-236)
      • expression tag (5-9)
      • modified residue (12)
      • modified residue (54)
      • modified residue (159)
      • cloning artifact (237-238)
    Domains in SCOPe 2.07: d1xxlb1, d1xxlb2, d1xxlb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxlA (A:)
    mahhhhhhslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevas
    sfaqekgvenvrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrf
    llvdhyapedpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqy
    dswikrggtpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxlA (A:)
    hhhslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqe
    kgvenvrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdh
    yapedpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswik
    rggtpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikreg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxlB (B:)
    mahhhhhhslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevas
    sfaqekgvenvrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrf
    llvdhyapedpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqy
    dswikrggtpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxlB (B:)
    hhhslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqe
    kgvenvrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdh
    yapedpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswik
    rggtpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikreg