PDB entry 1xxj

View 1xxj on RCSB PDB site
Description: Urate oxidase from aspergillus flavus complexed with 5-amino 6-nitro uracil
Class: oxidoreductase
Keywords: oxidoreductase, uric acid degradation, dimeric barrel, tunnel-shaped protein
Deposited on 2004-11-05, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.189
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xxja1, d1xxja2
  • Chain 'B':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xxjb1, d1xxjb2
  • Chain 'C':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xxjc1, d1xxjc2
  • Chain 'D':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xxjd1, d1xxjd2
  • Heterogens: UNC, BNZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxjA (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxjA (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxjB (B:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxjB (B:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxjC (C:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxjC (C:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxjD (D:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxjD (D:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrs