SCOP 1.75: Structural Classification of Proteins

PDB entry 1xxi

View 1xxi on RCSB PDB site
Description: ADP Bound E. coli Clamp Loader Complex
Class: transferase
Keywords: AAA+ ATPase, clamp loader, DNA polymerase III, DNA replication
Deposited on 2004-11-05, released 2004-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.366
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: DNA Polymerase III, DELTA SUBUNIT
Species: Escherichia coli
Gene: holA
Database cross-references and differences (RAF-indexed):
- Uniprot P28630 (0-End)
Domains in SCOP 1.75: d1xxia1, d1xxia2
Chain 'B':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710 (Start-367)
Domains in SCOP 1.75: d1xxib1, d1xxib2
Chain 'C':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710 (Start-367)
Domains in SCOP 1.75: d1xxic1, d1xxic2
Chain 'D':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710 (Start-367)
Domains in SCOP 1.75: d1xxid1, d1xxid2
Chain 'E':
Compound: DNA polymerase III, delta prime subunit
Species: Escherichia coli
Gene: HOLB
Database cross-references and differences (RAF-indexed):
- Uniprot P28631 (0-333)
Domains in SCOP 1.75: d1xxie1, d1xxie2
Chain 'F':
Compound: DNA Polymerase III, DELTA SUBUNIT
Species: Escherichia coli
Gene: holA
Database cross-references and differences (RAF-indexed):
- Uniprot P28630 (0-End)
Domains in SCOP 1.75: d1xxif1, d1xxif2
Chain 'G':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710 (Start-367)
Domains in SCOP 1.75: d1xxig1, d1xxig2
Chain 'H':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710 (Start-367)
Domains in SCOP 1.75: d1xxih1, d1xxih2
Chain 'I':
Compound: DNA polymerase III subunit gamma
Species: Escherichia coli
Gene: dnaX, dnaZ, dnaZX
Database cross-references and differences (RAF-indexed):
- Uniprot P06710 (Start-367)
Domains in SCOP 1.75: d1xxii1, d1xxii2
Chain 'J':
Compound: DNA polymerase III, delta prime subunit
Species: Escherichia coli
Gene: HOLB
Database cross-references and differences (RAF-indexed):
- Uniprot P28631 (0-333)
Domains in SCOP 1.75: d1xxij1, d1xxij2
Heterogens: PO4, ZN, ADP

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1xxiA (A:)
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg