PDB entry 1xxi

View 1xxi on RCSB PDB site
Description: ADP Bound E. coli Clamp Loader Complex
Deposited on 2004-11-05, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.366
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxiA (A:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiA (A:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkplad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxiB (B:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiB (B:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxiC (C:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiC (C:)
    yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
    ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
    ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
    irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
    tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
    gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
    mplpep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxiD (D:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiD (D:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxiE (E:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xxiF (F:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiF (F:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkplad
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xxiG (G:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiG (G:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xxiH (H:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiH (H:)
    yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
    ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
    ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
    irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
    tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
    gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
    mplpep
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xxiI (I:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxiI (I:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxiJ (J:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl