PDB entry 1xxh

View 1xxh on RCSB PDB site
Description: ATPgS Bound E. Coli Clamp Loader Complex
Class: transferase
Keywords: AAA+ ATPase clamp loader, gamma complex, DNA Polymerase III, DNA replication, TRANSFERASE
Deposited on 2004-11-05, released 2004-12-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.315
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase III, DELTA SUBUNIT
    Species: Escherichia coli [TaxId:562]
    Gene: holA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28630 (0-End)
      • modified residue (0)
      • modified residue (70)
      • modified residue (222)
      • modified residue (284-285)
    Domains in SCOPe 2.01: d1xxha1, d1xxha2
  • Chain 'B':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: dnaX, dnaZ, dnaZX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xxhb1, d1xxhb2
  • Chain 'C':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: dnaX, dnaZ, dnaZX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xxhc1, d1xxhc2
  • Chain 'D':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: dnaX, dnaZ, dnaZX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xxhd1, d1xxhd2
  • Chain 'E':
    Compound: DNA polymerase III, delta prime subunit
    Species: Escherichia coli [TaxId:562]
    Gene: HOLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28631 (0-333)
      • modified residue (0)
      • modified residue (34)
      • modified residue (67)
      • modified residue (181)
      • modified residue (252)
      • modified residue (300)
    Domains in SCOPe 2.01: d1xxhe1, d1xxhe2
  • Chain 'F':
    Compound: DNA Polymerase III, DELTA SUBUNIT
    Species: Escherichia coli [TaxId:562]
    Gene: holA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28630 (0-End)
      • modified residue (0)
      • modified residue (70)
      • modified residue (222)
      • modified residue (284-285)
    Domains in SCOPe 2.01: d1xxhf1, d1xxhf2
  • Chain 'G':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: dnaX, dnaZ, dnaZX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xxhg1, d1xxhg2
  • Chain 'H':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: dnaX, dnaZ, dnaZX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xxhh1, d1xxhh2
  • Chain 'I':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: dnaX, dnaZ, dnaZX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xxhi1, d1xxhi2
  • Chain 'J':
    Compound: DNA polymerase III, delta prime subunit
    Species: Escherichia coli [TaxId:562]
    Gene: HOLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28631 (0-333)
      • modified residue (0)
      • modified residue (34)
      • modified residue (67)
      • modified residue (181)
      • modified residue (252)
      • modified residue (300)
    Domains in SCOPe 2.01: d1xxhj1, d1xxhj2
  • Heterogens: ZN, PO4, ATG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxhA (A:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhA (A:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkplad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxhB (B:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhB (B:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxhC (C:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhC (C:)
    yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
    ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
    ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
    irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
    tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
    gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
    mplpep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxhD (D:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhD (D:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxhE (E:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xxhF (F:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkpladvfidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhF (F:)
    mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
    wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
    qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
    laqalerlsllwpdgkltlprveqavndaahftpfhwvdallmgkskralhilqqlrleg
    sepvillrtlqrellllvnlkrqsahtplralfdkhrvwqnrrgmmgealnrlsqtqlrq
    avqlltrteltlkqdygqsvwaeleglslllchkplad
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xxhG (G:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhG (G:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xxhH (H:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhH (H:)
    yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
    ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
    ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
    irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
    tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
    gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
    mplpep
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xxhI (I:)
    msyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllak
    glncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrf
    kvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldv
    eqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsam
    lgtldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspa
    algndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafh
    prmplpepevprq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxhI (I:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgtl
    dddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaalgn
    dmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhprmp
    lpep
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxhJ (J:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl