PDB entry 1xxg

View 1xxg on RCSB PDB site
Description: Crystal Structure of Staphylococcal Enterotoxin G
Class: immune system
Keywords: superantigen, T-cell receptor binding,crystal structure, immune system
Deposited on 2004-11-05, released 2006-02-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.231
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB YP_041290 (0-232)
      • engineered (5)
    Domains in SCOPe 2.03: d1xxga1, d1xxga2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxgA (A:)
    qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
    evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnssen
    erdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgy
    ikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxgA (A:)
    qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
    evktelentelannykgkkvdifgvpyfytciipksepfggccmyggltfnssenrdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth