PDB entry 1xxf

View 1xxf on RCSB PDB site
Description: Crystal Structure of the FXIa Catalytic Domain in Complex with Ecotin Mutant (EcotinP)
Class: blood clotting/hydrolase inhibitor
Keywords: FXIa; Catalytic Domain; Serine Protease; Ecotin; Substrate-like Interaction, BLOOD CLOTTING/HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-11-04, released 2004-11-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-End)
      • engineered (42)
      • engineered (87)
    Domains in SCOPe 2.01: d1xxfa_
  • Chain 'B':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-End)
      • engineered (42)
      • engineered (87)
    Domains in SCOPe 2.01: d1xxfb_
  • Chain 'C':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Gene: eco,eti
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (80-81)
      • engineered (83-85)
    Domains in SCOPe 2.01: d1xxfc_
  • Chain 'D':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Gene: eco,eti
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (80-81)
      • engineered (83-85)
    Domains in SCOPe 2.01: d1xxfd_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxfA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxfA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxfB (B:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxfB (B:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxfC (C:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspdftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxfC (C:)
    qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
    egwgydyyvfdkvsspdftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
    vkyrvwkaeekidnavvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxfD (D:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspdftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxfD (D:)
    qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
    egwgydyyvfdkvsspdftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
    vkyrvwkaeekidnavvr