PDB entry 1xxe

View 1xxe on RCSB PDB site
Description: RDC refined solution structure of the AaLpxC/TU-514 complex
Class: hydrolase
Keywords: LpxC; TU-514; LPS; lipid A; lipopolysaccharide UDP-3-O-acyl-N-acetylglucosamine deacetylase; metalloamidase; zinc metalloamidase, HYDROLASE
Deposited on 2004-11-04, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: lpxc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxea1, d1xxea2
  • Heterogens: ZN, TUX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxeA (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    cfdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltrdlphlpsvqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxeA (A:)
    lektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstdl
    gfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnreid
    yfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfcf
    dweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspv
    kgkfysfrgghslnvklvkelakkqklt