PDB entry 1xxd

View 1xxd on RCSB PDB site
Description: Crystal Structure of the FXIa Catalytic Domain in Complex with mutated Ecotin
Class: blood clotting/hydrolase inhibitor
Keywords: FXIa; Catalytic domain; Serine protein; Ecotin, BLOOD CLOTTING/HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-11-04, released 2004-11-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.23
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-237)
      • engineered (42)
      • engineered (87)
    Domains in SCOPe 2.01: d1xxda_
  • Chain 'B':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-237)
      • engineered (42)
      • engineered (87)
    Domains in SCOPe 2.01: d1xxdb_
  • Chain 'C':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Gene: eco,eti
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (79-81)
      • engineered (83-85)
    Domains in SCOPe 2.01: d1xxdc_
  • Chain 'D':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Gene: eco,eti
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (79-81)
      • engineered (83-85)
    Domains in SCOPe 2.01: d1xxdd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxdA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xxdB (B:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxdC (C:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxdC (C:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
    gwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
    kyrvwkaeekidnavvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxdD (D:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvssndftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxdD (D:)
    qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
    egwgydyyvfdkvssndftrvvckekkfvtaylgdagmlrynsklpivvytpdnvdvkyr
    vwkaeekidnavvr