PDB entry 1xxc

View 1xxc on RCSB PDB site
Description: c-terminal domain of escherichia coli arginine repressor
Class: DNA binding regulatory protein
Keywords: DNA binding regulatory protein
Deposited on 1995-11-03, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxca_
  • Chain 'B':
    Compound: Arginine repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxcb_
  • Chain 'C':
    Compound: Arginine repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxcc_
  • Chain 'D':
    Compound: Arginine repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxcd_
  • Chain 'E':
    Compound: Arginine repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxce_
  • Chain 'F':
    Compound: Arginine repressor
    Species: Escherichia coli [TaxId:83333]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xxcf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xxcA (A:)
    msplknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpang
    ftvkdlyeailelfdqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxcA (A:)
    plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
    vkdlyeailelf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xxcB (B:)
    msplknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpang
    ftvkdlyeailelfdqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxcB (B:)
    plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
    vkdlyeailelf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xxcC (C:)
    msplknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpang
    ftvkdlyeailelfdqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxcC (C:)
    plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
    vkdlyeailelf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xxcD (D:)
    msplknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpang
    ftvkdlyeailelfdqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxcD (D:)
    plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
    vkdlyeailelf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xxcE (E:)
    msplknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpang
    ftvkdlyeailelfdqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxcE (E:)
    plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
    vkdlyeailelf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xxcF (F:)
    msplknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpang
    ftvkdlyeailelfdqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xxcF (F:)
    plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
    vkdlyeailelf