PDB entry 1xx9

View 1xx9 on RCSB PDB site
Description: Crystal Structure of the FXIa Catalytic Domain in Complex with EcotinM84R
Class: blood clotting/hydrolase inhibitor
Keywords: FXIa; Catalytic domain; Serine protein; Ecotin, BLOOD CLOTTING-HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-11-04, released 2004-11-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xx9a_
  • Chain 'B':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xx9b_
  • Chain 'C':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Gene: eco,eti
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (83)
    Domains in SCOPe 2.01: d1xx9c_
  • Chain 'D':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Gene: eco,eti
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23827 (Start-141)
      • engineered (83)
    Domains in SCOPe 2.01: d1xx9d_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xx9A (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx9A (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xx9B (B:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx9B (B:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgyt
    dcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreggkdack
    gdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xx9C (C:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx9C (C:)
    svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk
    tlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn
    vdvkyrvwkaeekidnavvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xx9D (D:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx9D (D:)
    vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt
    legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv
    dvkyrvwkaeekidnavvr