PDB entry 1xx8

View 1xx8 on RCSB PDB site
Description: NMR Structure of the W24A Mutant of the Hyperthermophile Sac7d Protein
Class: DNA binding protein
Keywords: hyperthermophile, DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-11-04, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sac7d
  Species: Sulfolobus acidocaldarius [TaxId:2285]
  Gene: sac7d
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (0-65)
    • engineered (23)
  Domains in SCOPe 2.08: d1xx8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xx8A (A:)
  mvkvkfkykgeekevdtskikkvarvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekk