PDB entry 1xx8

View 1xx8 on RCSB PDB site
Description: NMR Structure of the W24A Mutant of the Hyperthermophile Sac7d Protein
Class: DNA binding protein
Keywords: hyperthermophile, DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-11-04, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sac7d
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: sac7d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123 (0-65)
      • engineered (23)
    Domains in SCOPe 2.07: d1xx8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xx8A (A:)
    mvkvkfkykgeekevdtskikkvarvgkmvsftyddngktgrgavsekdapkelldmlar
    aerekk