PDB entry 1xx6

View 1xx6 on RCSB PDB site
Description: X-ray structure of Clostridium acetobutylicum thymidine kinase with ADP. Northeast Structural Genomics Target CAR26.
Class: transferase
Keywords: NESG, Northeast Structural Genomics Consortium, Protein Structure Initiative, PSI, Structural Genomics, DNA synthesis, kinase, transferase, thymidine
Deposited on 2004-11-04, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97F65 (Start-190)
      • modified residue (16)
      • modified residue (58)
      • modified residue (117)
      • modified residue (131)
      • modified residue (175)
    Domains in SCOPe 2.07: d1xx6a1, d1xx6a2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97F65 (Start-190)
      • modified residue (16)
      • modified residue (117)
      • modified residue (131)
      • modified residue (175)
    Domains in SCOPe 2.07: d1xx6b1, d1xx6b2
  • Heterogens: ZN, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xx6A (A:)
    myrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeidnryskedvvshmg
    ekeqavaiknsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdf
    rgkpfgpipelmaiaefvdkiqaicvvcgnpatrtqrlingkpafyddpvvligamesye
    arcrkchvvpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx6A (A:)
    yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeedvvshmgekeqavai
    knsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdfrgkpfgpi
    pelmaiaefvdkiqaicvvcgnpatrtqrlingkpafyddpvmesyearcrkchvvpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xx6B (B:)
    myrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeidnryskedvvshmg
    ekeqavaiknsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdf
    rgkpfgpipelmaiaefvdkiqaicvvcgnpatrtqrlingkpafyddpvvligamesye
    arcrkchvvpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx6B (B:)
    yrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeavaiknsreilkyfee
    dteviaidevqffddeiveivnkiaesgrrvicagldmdfrgkpfgpipelmaiaefvdk
    iqaicvvcgnpatrtqrlingkpafyddpvmesyearcrkchvvpq