PDB entry 1xx3

View 1xx3 on RCSB PDB site
Description: Solution Structure of Escherichia coli TonB-CTD
Class: transport protein
Keywords: TonB-CTD, C-terminal domain, NMR, TRANSPORT PROTEIN
Deposited on 2004-11-03, released 2005-02-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TonB protein
    Species: Escherichia coli [TaxId:562]
    Gene: tonB, exbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xx3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xx3A (A:)
mhhhhhhvkkvqeqpkrdvkpvesrpaspfentaparltsstataatskpvtsvasgpra
lsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwry
epgkpgsgivvnilfkingtteiq

    Sequence, based on observed residues (ATOM records): (download) 
    >1xx3A (A:)
sgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknam
rrwryepgkpgsgivvnilfkingtteiq