PDB entry 1xx1

View 1xx1 on RCSB PDB site
Description: structural basis for ion-coordination and the catalytic mechanism of sphingomyelinases d
Deposited on 2004-11-03, released 2005-01-18
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sphingomyelinase I
    Species: Loxosceles laeta [TaxId:58217]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sphingomyelinase I
    Species: Loxosceles laeta [TaxId:58217]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sphingomyelinase I
    Species: Loxosceles laeta [TaxId:58217]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Sphingomyelinase I
    Species: Loxosceles laeta [TaxId:58217]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, MG, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xx1A (A:)
    adnrrpiwnlahmvnavaqipdfldlganaleadvtfkgsvptytyhgtpcdfgrdcirw
    eyfnvflktlreyttpgnakyrdgfilfvldlktgslsndqvrpagenvakellqnywnn
    gnnggrayvvlslpdighyefvrgfkevlkkeghedllekvgydfsgpylpslptldath
    eaykkagvdghiwlsdgltnfsplgdmarlkeaiksrdsangfinkiyywsvdkvsttka
    aldvgvdgimtnypnvligvlkesgyndkyrlatyddnpwetfkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xx1B (B:)
    adnrrpiwnlahmvnavaqipdfldlganaleadvtfkgsvptytyhgtpcdfgrdcirw
    eyfnvflktlreyttpgnakyrdgfilfvldlktgslsndqvrpagenvakellqnywnn
    gnnggrayvvlslpdighyefvrgfkevlkkeghedllekvgydfsgpylpslptldath
    eaykkagvdghiwlsdgltnfsplgdmarlkeaiksrdsangfinkiyywsvdkvsttka
    aldvgvdgimtnypnvligvlkesgyndkyrlatyddnpwetfkn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1xx1C (C:)
    adnrrpiwnlahmvnavaqipdfldlganaleadvtfkgsvptytyhgtpcdfgrdcirw
    eyfnvflktlreyttpgnakyrdgfilfvldlktgslsndqvrpagenvakellqnywnn
    gnnggrayvvlslpdighyefvrgfkevlkkeghedllekvgydfsgpylpslptldath
    eaykkagvdghiwlsdgltnfsplgdmarlkeaiksrdsangfinkiyywsvdkvsttka
    aldvgvdgimtnypnvligvlkesgyndkyrlatyddnpwetfkn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1xx1D (D:)
    adnrrpiwnlahmvnavaqipdfldlganaleadvtfkgsvptytyhgtpcdfgrdcirw
    eyfnvflktlreyttpgnakyrdgfilfvldlktgslsndqvrpagenvakellqnywnn
    gnnggrayvvlslpdighyefvrgfkevlkkeghedllekvgydfsgpylpslptldath
    eaykkagvdghiwlsdgltnfsplgdmarlkeaiksrdsangfinkiyywsvdkvsttka
    aldvgvdgimtnypnvligvlkesgyndkyrlatyddnpwetfkn