PDB entry 1xx0

View 1xx0 on RCSB PDB site
Description: Structure of the C-terminal PH domain of human pleckstrin
Class: lipid binding protein
Keywords: pleckstrin, PH, C-terminal, pleckstrin homology, LIPID BINDING PROTEIN
Deposited on 2004-11-03, released 2005-05-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xx0a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xx0A (A:)
mkhhhhhhpmdvilkeefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpaga
edplgaihlrgcvvtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiq
masrtgk

    Sequence, based on observed residues (ATOM records): (download) 
    >1xx0A (A:)
dvilkeefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlr
gcvvtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasrtgk