PDB entry 1xwy

View 1xwy on RCSB PDB site
Description: Crystal structure of tatD deoxyribonuclease from Escherichia coli K12 at 2.0 A resolution
Class: hydrolase
Keywords: tatD, TIM BARRAEL, deoxyribonuclease, zinc ion, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2004-11-02, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deoxyribonuclease tatD
    Species: Escherichia coli [TaxId:562]
    Gene: tatD, mttC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwya1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwyA (A:)
    meyrmfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscw
    stagvhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlri
    aadlnmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgw
    vcderrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahw
    rgedaawlaattdanvktlfgiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwyA (A:)
    mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag
    vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl
    nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde
    rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged
    aawlaattdanvktlfgiaf