PDB entry 1xww

View 1xww on RCSB PDB site
Description: Crystal Structure of Human B-form Low Molecular Weight Phosphotyrosyl Phosphatase at 1.6 Angstrom Resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-11-02, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.164
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwwa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xwwA (A:)
aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwvidsgavsdwnvgrspdprav
sclrnhgihtahkarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
pqkqliiedpyygndsdfetvyqqcvrccraflekah