PDB entry 1xws

View 1xws on RCSB PDB site
Description: Crystal Structure of the human PIM1 kinase domain
Class: transferase
Keywords: PIM1, kinase, cancer, leukemia
Deposited on 2004-11-02, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwsa_
  • Heterogens: SO4, BI1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwsA (A:)
    mllskinslahlraapcndlhatklapgkekeplesqyqvgpllgsggfgsvysgirvsd
    nlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgfsgvirlldwferpdsfvlil
    erpepvqdlfdfitergalqeelarsffwqvleavrhchncgvlhrdikdenilidlnrg
    elklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaavwslgillydmvcgdi
    pfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqeta
    eihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwsA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh