PDB entry 1xwr

View 1xwr on RCSB PDB site
Description: Crystal structure of the coliphage lambda transcription activator protein CII
Class: DNA binding protein
Keywords: all-alpha fold, DNA binding protein
Deposited on 2004-11-02, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.25
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein CII
    Species: BACTERIOPHAGE LAMBDA [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwra1
  • Chain 'B':
    Compound: Regulatory protein CII
    Species: BACTERIOPHAGE LAMBDA [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwrb_
  • Chain 'C':
    Compound: Regulatory protein CII
    Species: BACTERIOPHAGE LAMBDA [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwrc_
  • Chain 'D':
    Compound: Regulatory protein CII
    Species: BACTERIOPHAGE LAMBDA [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwrd_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwrA (A:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwrA (A:)
    vrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewg
    vvdddmarlarqvaailtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xwrB (B:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwrB (B:)
    ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
    dddmarlarqvaailtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xwrC (C:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwrC (C:)
    ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
    dddmarlarqvaailt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xwrD (D:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwrD (D:)
    ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
    dddmarlarqvaailtn