PDB entry 1xwo

View 1xwo on RCSB PDB site
Description: crystal structrue of goose delta crystallin
Class: lyase
Keywords: Alpha helix bundle, double dimer, lyase
Deposited on 2004-11-02, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta crystallin
    Species: Anser anser anser [TaxId:8844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwoa_
  • Chain 'B':
    Compound: Delta crystallin
    Species: Anser anser anser [TaxId:8844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwob_
  • Chain 'C':
    Compound: Delta crystallin
    Species: Anser anser anser [TaxId:8844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwoc_
  • Chain 'D':
    Compound: Delta crystallin
    Species: Anser anser anser [TaxId:8844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwoA (A:)
    asegdklmggrfvgstdpimqmlstsmsteqrlsevdiqasiayakalekagiltktele
    kilsglekiseewskgvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdl
    klfmknslsvisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshavalt
    rdserlgevkrrinvlplgsgalagnpldidremlrseldfasislnsmdaiserdfvve
    flsvatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirskag
    rvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenme
    kaltpemlstdlalylvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfs
    sdvsqvfnfvnsveqytamggtakssvttqiehlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwoA (A:)
    tdpimqmlstsmsteqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
    gvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdlklfmknslsvisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkrrinv
    lplgsgalagnpldidremlrseldfasislnsmdaiserdfvveflsvatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlstdlaly
    lvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfssdvsqvfnfvnsveq
    ytamggtakssvttqiehlrelmkkqke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xwoB (B:)
    asegdklmggrfvgstdpimqmlstsmsteqrlsevdiqasiayakalekagiltktele
    kilsglekiseewskgvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdl
    klfmknslsvisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshavalt
    rdserlgevkrrinvlplgsgalagnpldidremlrseldfasislnsmdaiserdfvve
    flsvatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirskag
    rvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenme
    kaltpemlstdlalylvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfs
    sdvsqvfnfvnsveqytamggtakssvttqiehlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwoB (B:)
    stdpimqmlstsmsteqrlsevdiqasiayakalekagiltktelekilsglekiseews
    kgvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdlklfmknslsvisth
    llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkrrin
    vlplgsgalagnpldidremlrseldfasislnsmdaiserdfvveflsvatllmihlsk
    maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
    glpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlstdlal
    ylvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfssdvsqvfnfvnsve
    qytamggtakssvttqiehlrelmkkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xwoC (C:)
    asegdklmggrfvgstdpimqmlstsmsteqrlsevdiqasiayakalekagiltktele
    kilsglekiseewskgvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdl
    klfmknslsvisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshavalt
    rdserlgevkrrinvlplgsgalagnpldidremlrseldfasislnsmdaiserdfvve
    flsvatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirskag
    rvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenme
    kaltpemlstdlalylvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfs
    sdvsqvfnfvnsveqytamggtakssvttqiehlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwoC (C:)
    stdpimqmlstsmsteqrlsevdiqasiayakalekagiltktelekilsglekiseews
    kgvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdlklfmknslsvisth
    llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkrrin
    vlplgsgalagnpldidremlrseldfasislnsmdaiserdfvveflsvatllmihlsk
    maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
    glpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlstdlal
    ylvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfssdvsqvfnfvnsve
    qytamggtakssvttqiehlrelmkkqke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xwoD (D:)
    asegdklmggrfvgstdpimqmlstsmsteqrlsevdiqasiayakalekagiltktele
    kilsglekiseewskgvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdl
    klfmknslsvisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshavalt
    rdserlgevkrrinvlplgsgalagnpldidremlrseldfasislnsmdaiserdfvve
    flsvatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirskag
    rvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenme
    kaltpemlstdlalylvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfs
    sdvsqvfnfvnsveqytamggtakssvttqiehlrelmkkqkeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwoD (D:)
    tdpimqmlstsmsteqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
    gvfvvtqsdedihtanerrlkeligdiagklntgrsrneqvvtdlklfmknslsvisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkrrinv
    lplgsgalagnpldidremlrseldfasislnsmdaiserdfvveflsvatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlstdlaly
    lvrkgmpfrqahtasgkavhlaetkgitinnltledlksisplfssdvsqvfnfvnsveq
    ytamggtakssvttqiehlrelmkkqkeq