PDB entry 1xwm

View 1xwm on RCSB PDB site
Description: The crystal structure of PhoU (phosphate uptake regulator), Structural genomics
Class: structural genomics, unknown function
Keywords: PhoU, Negative phosphate uptake regulator, Structural genomics, protein structure initiative, PSI, MCSG, Midwest center for structural genomics
Deposited on 2004-11-01, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate uptake regulator
    Species: Bacillus stearothermophilus
    Gene: RBSTP1653
    Domains in SCOP 1.73: d1xwma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwmA (A:)
    mretfaddlaslhnkliemgrltevalqqaieafqtqnanlamavidgdgsidaleeevn
    dfalwliaaqqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplv
    lmyrlatdmvstaiaaydredaslaaqiadmdhrvdeqygemmasllavaktdaatlaqm
    nvlalvaryiertadhatniaehlvylvkgkhydfnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwmA (A:)
    tfaddlaslhnkliemgrltevalqqaieafqtqnanlamavidgdgsidaleeevndfa
    lwliaaqqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplvlmy
    rlatdmvstaiaaydredaslaaqiadmdhrvdeqygemmasllavaktdaatlaqmnvl
    alvaryiertadhatniaehlvylvkgkhydf