PDB entry 1xwk

View 1xwk on RCSB PDB site
Description: 2.3 angstrom resolution crystal structure of human glutathione S-transferase M1A-1A complexed with glutathionyl-S-dinitrobenzene
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, dimer, active site, glutathionyl-s-dinitrobenzene, gs-dnb, 1-chloro-2,4-dinitrobenzene, cdnb
Deposited on 2004-11-01, released 2004-12-21
The last revision prior to the SCOP 1.75 freeze date was dated 2008-12-23, with a file datestamp of 2008-12-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xwka1, d1xwka2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xwkb1, d1xwkb2
  • Chain 'C':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xwkc1, d1xwkc2
  • Heterogens: GDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwkA (A:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwkA (A:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xwkB (B:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwkB (B:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xwkC (C:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwkC (C:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk