PDB entry 1xwj

View 1xwj on RCSB PDB site
Description: Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
Deposited on 2004-11-01, released 2005-10-11
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.241
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12003 (22-End)
      • expression tag (20-21)
  • Chain 'B':
    Compound: Talin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xwjA (A:)
    mgsshhhhhhssglvprgshmmpvfhtrtiesilepvaqqishlvimheegevdgkaipd
    ltapvsavqaavsnlvrvgketvqttedqilkrdmppafikvenactklvraaqmlqadp
    ysvpardylidgsrgilsgtsdllltfdeaevrkiirvckgileyltvaevvetmedlvt
    ytknlgpgmtkmakmiderqqelthqehrvmlvnsmntvkellpvlisamkifvttkntk
    sqgieealknrnftvekmsaeineiirvlqltswdedawa
    

    Sequence, based on observed residues (ATOM records):
    >1xwjA (A:)
    mmpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgk
    etvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgt
    sdllltfdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderq
    qelthqehrvmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsa
    eineiirvlqlts
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xwjB (B:)
    ytkkeliesarkvsekvshvlaalqa
    

    Sequence, based on observed residues (ATOM records):
    >1xwjB (B:)
    kkeliesarkvsekvshvlaalqa