PDB entry 1xwi

View 1xwi on RCSB PDB site
Description: Crystal Structure of VPS4B
Deposited on 2004-11-01, released 2005-10-11
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SKD1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS4B, SKD1, VPS42
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xwiA (A:)
    aivierpnvkwsdvaglegakealkeavilpikfphlftgkrtpwrgillfgppgtgksy
    lakavateannstffsisssdlvskwlgeseklvknlfqlarenkpsiifideidslcgs
    rseneseaarrikteflvqmqgvgvdndgilvlgatnipwvldsairrrfekriyiplpe
    pharaamfklhlgttqnslteadfrelgrktdgysgadisiivrdalmqpvrkvqsathf
    kkvrgpsradpnhlvddlltpcspgdpgaiemtwmdvpgdkllepvvsmsdmlrslsntk
    ptvnehdllklkkftedfgqeg